PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G018500.1
Common NamePOPTR_0017s04980g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 988aa    MW: 108478 Da    PI: 5.3594
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G018500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29598649152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Potri.017G018500.1 598 AEKTVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 649
                         5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.086581669IPR003035RWP-RK domain
PfamPF020423.6E-26601649IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2401.1E-24885964No hitNo description
SuperFamilySSF542772.26E-21885969No hitNo description
PROSITE profilePS5174520.772885967IPR000270PB1 domain
SMARTSM006668.0E-22885967IPR000270PB1 domain
CDDcd064078.86E-31886966No hitNo description
PfamPF005641.5E-17886966IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 988 aa     Download sequence    Send to blast
MENPFSSKEK GTGYWASPRA QMDVVTPLDG SPRNLLLEDP FNNFSELMNF DIYAELCNNP  60
SAMDQMLDPF GMPSFPSTSS PSFDPGSFAA LNSAPVQNTT NAAGTSYNDG DKVVLQQINS  120
HFCYPSDSID TDDLGAKHSN DAGQQNRFSN LTDHIIARPL APSLDERMLR ALSLLKVSSG  180
GGFLAQVWVP RRIGNQYMLS TTDQPYLLDE MLAGFREVSR TFTFPAEVKP GLPLGLPGRV  240
FISKVPEWTS NVIYYSKGEY LRAKQAADHE VRGSFALPIF DPDEMSCCAV LELVTMKEKP  300
DFDSEMENVC HALEAVNLRS TAPPRLLPQC LSSNKRAALS EIADVLRAVC HAHRLPLALT  360
WIPCNYTEEA LDEIVKVRVR EANSRSSGKC VLCIEDTACY VNDRKMQGFV HACAEHYIEE  420
GQGLAGKALQ SNHPFFFSDV KAYDITEYPL VHHARKYGLN AAVAIRLRST YTGDEDYILE  480
FFLPVNIEGS SDQQLLLNNL SGTMQRICKS LRTVSETEFV RQECSEDGLP KEAVPSVRPM  540
SISKGSSQTA ISEGNLNSAA KMLFNMSGSK NDQTESNSSN EQKMSGSRRQ VEKKRSTAEK  600
TVSLSVLQQY FSGSLKDAAK SIGVCPTTLK RICRQHGISR WPSRKINKVN RSLKKIQTVL  660
DTVQGVEGGL KFDPTAGGFI AGGAMMQEFD LRNGFVFQEK NLSNRNSDPA NHDVVSVRPA  720
PCTDGNNSTV KVENDECHIG SRGVLKESCV HVIDCSEDAK SAAVDAGLCE QANFGSGPWA  780
CLENDITVSL AKAGNKWGMK NGGIILENLD SHFVSQSSSS FAKEMDTKME GDDGNVEHNQ  840
PTSSSMTDSS NGTGSMMHGS ISSSSSFEER KHSKVQTSFC DGDLKITVKA SYKEDIIRFK  900
FDPSAGCLQL YKEVSNRFKL QTGTFQLKYL DDEEEWVLLV SDSDLQECLE IMEYVGTRNV  960
KFLVRDAVAP FVMGSSGSSN SFLVGSS*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2316381e-108CU231638.1 Populus EST from mild drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372780.10.0hypothetical protein POPTR_0017s04980g
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLU5FMK20.0U5FMK2_POPTR; Uncharacterized protein
STRINGPOPTR_0017s04980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein